PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_40532
Common NameKK1_042188
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family MYB
Protein Properties Length: 313aa    MW: 35339 Da    PI: 6.6206
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_40532genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.32.3e-152269148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W+++Ede+l+++    G g+W+ Iar  g+ R++k+c++rw +yl
    C.cajan_40532 22 KGLWSPDEDEKLIRYMLTNGQGCWSDIARNAGLQRCGKSCRLRWINYL 69
                     678*******************************************97 PP

2Myb_DNA-binding50.93.6e-1675119147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+++++E++l+++++  lG++ W+ Ia++++ gRt++++k++w++ 
    C.cajan_40532  75 RGAFSPQEEDLIIHLHSILGNR-WSQIAARLP-GRTDNEIKNFWNST 119
                      89********************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.7231769IPR017930Myb domain
SuperFamilySSF466891.64E-2820116IPR009057Homeodomain-like
SMARTSM007175.8E-122171IPR001005SANT/Myb domain
PfamPF002495.5E-142269IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.9E-232376IPR009057Homeodomain-like
CDDcd001671.83E-102569No hitNo description
PROSITE profilePS5129425.65570124IPR017930Myb domain
SMARTSM007174.5E-1674122IPR001005SANT/Myb domain
PfamPF002494.8E-1575119IPR001005SANT/Myb domain
CDDcd001671.31E-1177120No hitNo description
Gene3DG3DSA:1.10.10.604.6E-2677125IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MRKPDLMANK DKVNNIKIKL RKGLWSPDED EKLIRYMLTN GQGCWSDIAR NAGLQRCGKS  60
CRLRWINYLR PDLKRGAFSP QEEDLIIHLH SILGNRWSQI AARLPGRTDN EIKNFWNSTL  120
KKRLKTNTCT PSLNNSTDSS ESKDVLSGIM PFNEHDIMTM CMDSSSSISS MQAMALPDQF  180
DPFSMFVNNN QCDMTTNVSP NFPNMPASCM TQIGMVEGHQ GNYGVLEPTK MGLGLPSLES  240
RSIESNSVPI DVKSHNNNHF NYGSFNNTDK IQGSKVEDLI GFGNHGQGEN LKMGEWDLEN  300
LMQDITSFPF LEF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-27201265110B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1119125LKKRLKT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150391e-88AP015039.1 Vigna angularis var. angularis DNA, chromosome 6, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006592969.10.0PREDICTED: transcription factor MYB86-like
TrEMBLA0A151R2650.0A0A151R265_CAJCA; Transcription factor MYB46
STRINGGLYMA12G36630.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77434128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G08500.17e-80myb domain protein 83